ICT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55014

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ICT Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ICT1(immature colon carcinoma transcript 1) The peptide sequence was selected from the middle region of ICT1. Peptide sequence AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ICT Antibody - BSA Free

Western Blot: ICT Antibody [NBP1-55014]

Western Blot: ICT Antibody [NBP1-55014]

Western Blot: ICT Antibody [NBP1-55014] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Applications for ICT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ICT

The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells.The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells.

Alternate Names

Digestion substraction 1, DS-1DS1, EC 3.1.1.29, immature colon carcinoma transcript 1, Immature colon carcinoma transcript 1 protein, peptidyl-tRNA hydrolase ICT1, mitochondrial

Gene Symbol

MRPL58

UniProt

Q14197 (Human)

Additional ICT Products

Product Documents for ICT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ICT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ICT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ICT Antibody - BSA Free and earn rewards!

Have you used ICT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies