MEIOB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85269

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MEIOB Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MEIOB. Peptide sequence: ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MEIOB Antibody - BSA Free

Western Blot: MEIOB Antibody [NBP2-85269]

Western Blot: MEIOB Antibody [NBP2-85269]

Western Blot: MEIOB Antibody [NBP2-85269] - Host: Rabbit. Target: MEIOB. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): Human Liver (LI). Antibody concentration: 1ug/ml
Western Blot: MEIOB Antibody [NBP2-85269]

Western Blot: MEIOB Antibody [NBP2-85269]

Western Blot: MEIOB Antibody [NBP2-85269] - Host: Rabbit. Target Name: MEIOB. Sample Type: Uterus Tumor lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MEIOB Antibody [NBP2-85269]

Western Blot: MEIOB Antibody [NBP2-85269]

Western Blot: MEIOB Antibody [NBP2-85269] - Host: Rabbit. Target Name: MEIOB. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for MEIOB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MEIOB

Alternate Names

C16orf73, chromosome 16 open reading frame 73, gs129, meiosis specific with OB domains

Gene Symbol

MEIOB

Additional MEIOB Products

Product Documents for MEIOB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MEIOB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MEIOB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MEIOB Antibody - BSA Free and earn rewards!

Have you used MEIOB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies