Membrin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87800

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Membrin Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Membrin. Peptide sequence: ASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Membrin Antibody - BSA Free

Western Blot: Membrin Antibody [NBP2-87800]

Western Blot: Membrin Antibody [NBP2-87800]

Western Blot: Membrin Antibody [NBP2-87800] - WB Suggested Anti-GOSR2 Antibody. Titration: 1.0 ug/ml. Positive Control: MDA-MB-435S Whole CellThere is BioGPS gene expression data showing that GOSR2 is expressed in MDA-MB435

Applications for Membrin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Membrin

Membrin encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

golgi SNAP receptor complex member 2, GS27Bos1,27 kDa Golgi SNARE protein, membrin

Gene Symbol

GOSR2

Additional Membrin Products

Product Documents for Membrin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Membrin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Membrin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Membrin Antibody - BSA Free and earn rewards!

Have you used Membrin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies