MPST Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54734

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MPST Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MPST Antibody - BSA Free

Western Blot: MPST Antibody [NBP1-54734]

Western Blot: MPST Antibody [NBP1-54734]

Western Blot: MPST Antibody [NBP1-54734] - Lane 1 : 40 ug Human Liver lysate Lane 2: 40 ug Mouse Liver lysate Lane 3: 40 ug Rat Liver lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit Secondary Antibody conjugated with Alexa Fluor 647 Secondary, Antibody Dilution: 1 : 2500.
Western Blot: MPST Antibody [NBP1-54734]

Western Blot: MPST Antibody [NBP1-54734]

Western Blot: MPST Antibody [NBP1-54734] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for MPST Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPST

MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.This gene encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.

Alternate Names

mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

Entrez Gene IDs

4357 (Human)

Gene Symbol

MPST

UniProt

P25325 (Human)

Additional MPST Products

Product Documents for MPST Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MPST Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MPST Antibody - BSA Free

Customer Reviews for MPST Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPST Antibody - BSA Free and earn rewards!

Have you used MPST Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies