Nova2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85393

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Nova2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Nova2. Peptide sequence: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Nova2 Antibody - BSA Free

Western Blot: Nova2 Antibody [NBP2-85393]

Western Blot: Nova2 Antibody [NBP2-85393]

Western Blot: Nova2 Antibody [NBP2-85393] - Lanes: 1. 10 ug human neural cell lysate. 2. 10 ug human non-neural cell lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit IRDye 800 (1hr room temperature). Secondary Antibody Dilution: 1:15,000. Gene Name: NOVA2. Submitted by: Dr. Monica Faronato, University of Liverpool.
Western Blot: Nova2 Antibody [NBP2-85393]

Western Blot: Nova2 Antibody [NBP2-85393]

Western Blot: Nova2 Antibody [NBP2-85393] - WB Suggested Anti-NOVA2 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate

Applications for Nova2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Nova2

Nova2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. Binds single strand RNA

Alternate Names

neuro-oncological ventral antigen 2ANOVANOVA3Astrocytic NOVA1-like RNA-binding protein, neuro-oncological ventral antigen 3, RNA-binding protein Nova-2

Gene Symbol

NOVA2

Additional Nova2 Products

Product Documents for Nova2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Nova2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Nova2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Nova2 Antibody - BSA Free and earn rewards!

Have you used Nova2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies