PCGF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88019

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PCGF3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCGF3. Peptide sequence: EVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PCGF3 Antibody - BSA Free

Western Blot: PCGF3 Antibody [NBP2-88019]

Western Blot: PCGF3 Antibody [NBP2-88019]

Western Blot: PCGF3 Antibody [NBP2-88019] - WB Suggested Anti-PCGF3 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain

Applications for PCGF3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PCGF3

PCGF3 is encoded by this gene contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined

Alternate Names

DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, polycomb group ring finger 3, polycomb group RING finger protein 3, ring finger protein 3, RNF3, RNF3ARING finger protein 3A

Gene Symbol

PCGF3

Additional PCGF3 Products

Product Documents for PCGF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PCGF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PCGF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PCGF3 Antibody - BSA Free and earn rewards!

Have you used PCGF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies