PDLIM3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55197

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PDLIM3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PDLIM3(PDZ and LIM domain 3) The peptide sequence was selected from the N terminal of PDLIM3. Peptide sequence PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PDLIM3 Antibody - BSA Free

Western Blot: PDLIM3 Antibody [NBP1-55197]

Western Blot: PDLIM3 Antibody [NBP1-55197]

Western Blot: PDLIM3 Antibody [NBP1-55197] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for PDLIM3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PDLIM3

PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Alternate Names

Actinin-associated LIM protein, ALPFLJ26096, Alpha-actinin-2-associated LIM protein, DKFZp686L0362, enigma homolog, PDZ and LIM domain 3, PDZ and LIM domain protein 3

Gene Symbol

PDLIM3

UniProt

Q53GG5 (Human)

Additional PDLIM3 Products

Product Documents for PDLIM3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PDLIM3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PDLIM3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PDLIM3 Antibody - BSA Free and earn rewards!

Have you used PDLIM3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies