Catalog Number: 1618
Alternate Names: PYY 3-36
Biological Activity
Y2 selective agonist. IC50 values are 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.
Technical Data
  • M.Wt:
    3980.4
  • Formula:
    C176H272N52O54
  • Sequence:
    AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

    (Modifications: Tyr-34 = C-terminal amide)

  • Solubility:
    Soluble to 1 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    126339-09-1
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Gut hormone PYY3-36 physiologically inhibits food intake.
    Batterham et al.
    Nature, 2002;418:650
  2. Primary structures of PYY, [Pro34]PYY and PYY-(3-36) confer different conformations and receptor selectivity.
    Keire et al.
    Am.J.Physiol.Gastrointest.Liver Physiol., 2000;279:G126
  3. Characterization of blood-brain barrier permeability to PYY3-36 in the mouse.
    Nonaka et al.
    J.Pharmacol.Exp.Ther., 2003;306:948
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Peptide YY (3-36) include:

1 Citations: Showing 1 - 1

  1. Peptide YY3-36 and 5-hydroxytryptamine mediate emesis induction by trichothecene deoxynivalenol (vomitoxin).
    Authors: Wu Et al.
    Toxicol Sci 2013;133:186

Have you used Peptide YY (3-36)?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information