PITX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82383

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PITX1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide towards Pitx1. Peptide sequence LCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PITX1 Antibody - BSA Free

Western Blot: PITX1 Antibody [NBP1-82383]

Western Blot: PITX1 Antibody [NBP1-82383]

Western Blot: PITX1 Antibody [NBP1-82383] - Rat Liver Lysate 1.0 ug/ml, gel concentration 12%

Applications for PITX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PITX1

PITX1 encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Alternate Names

BFTpituitary homeobox 1, CCF, Hindlimb-expressed homeobox protein backfoot, Homeobox protein PITX1, paired-like homeodomain 1, pituitary otx-related factor, POTXpituitary homeo box 1, PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot

Gene Symbol

PITX1

UniProt

NP_446076 (Rat)

Additional PITX1 Products

Product Documents for PITX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PITX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PITX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PITX1 Antibody - BSA Free and earn rewards!

Have you used PITX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies