PLSCR4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85501

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PLSCR4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLSCR4. Peptide sequence: HWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PLSCR4 Antibody - BSA Free

Western Blot: PLSCR4 Antibody [NBP2-85501]

Western Blot: PLSCR4 Antibody [NBP2-85501]

Western Blot: PLSCR4 Antibody [NBP2-85501] - WB Suggested Anti-PLSCR4 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Applications for PLSCR4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PLSCR4

PLSCR4 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon bindingcalcium ions that results in a loss of phospholipid asymmetry inthe plasma membrane. May play a central role in theinitiation of fibrin clot formati

Alternate Names

Ca(2+)-dependent phospholipid scramblase 4, cell growth inhibiting protein 43, Cell growth-inhibiting gene 43 protein, phospholipid scramblase 4, PL scramblase 4, TRA1

Gene Symbol

PLSCR4

Additional PLSCR4 Products

Product Documents for PLSCR4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PLSCR4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PLSCR4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PLSCR4 Antibody - BSA Free and earn rewards!

Have you used PLSCR4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies