POLD3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85512

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all POLD3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of POLD3. Peptide sequence: EEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for POLD3 Antibody - BSA Free

Western Blot: POLD3 Antibody [NBP2-85512]

Western Blot: POLD3 Antibody [NBP2-85512]

Western Blot: POLD3 Antibody [NBP2-85512] - WB Suggested Anti-POLD3 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole CellPOLD3 is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for POLD3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLD3

PolD3/p66 is a subunit of the heterotetrameric DNA polymerase delta that plays a role in DNA replication and repair. The PolD3/p66 subunit has been shown to mediate the interaction between DNA polymerase delta and PCNA (proliferating cell nuclear antigen) to facilitate processivity.

Alternate Names

DNA polymerase delta subunit 3, DNA polymerase delta subunit p66, DNA polymerase delta, subunit 3, KIAA0039MGC119643, MGC119642, P66, P68, polymerase (DNA directed), delta 3, polymerase (DNA-directed), delta 3, accessory subunit

Gene Symbol

POLD3

Additional POLD3 Products

Product Documents for POLD3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for POLD3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLD3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLD3 Antibody - BSA Free and earn rewards!

Have you used POLD3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies