Biological Activity
[Pro3]-GIP (Mouse) is a GIP receptor antagonist (IC50 = 2.6μM). Inhibits GIP-stimulated insulin release from pancreatic β cells in vitro. In ob/ob mice, blocks the effects of GIP on insulin release and plasma glucose levels. Also improves intraperitoneal glucose tolerance, insulin sensitivity, and glucose response to feeding in ob/ob mice.Technical Data
M.Wt:
4971.62
Formula:
C225H342N62O64S
Sequence:
YAPGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ
Solubility:
Soluble to 2 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Background References
-
Early administration of the glucose-dependent Insotropic polypeptide receptor antagonist (Pro3)GIP prevents the development of diabetes and related metabolic abnormalities associated with genetically inherited obesity in ob/ob mice.
Irwin et al.
Diabetologia, 2007;50:1532 -
Characterization of the cellular and metabolic effects of a novel enzyme-resistant antagonist of glucose-dependent Insotropic polypeptide.
Gault et al.
Biochem.Biophys.Res.Commun., 2002;290:1420
Product Datasheets
Or select another batch:
Reconstitution Calculator
Molarity Calculator
Reconstitution Calculator
Molarity Calculator
FAQs
No product specific FAQs exist for this product, however you may
View all Peptide FAQsVersaClone cDNA Plasmids
Reviews for [Pro3]-GIP (Mouse)
There are currently no reviews for this product. Be the first to review [Pro3]-GIP (Mouse) and earn rewards!
Have you used [Pro3]-GIP (Mouse)?
Submit a review and receive an Amazon gift card.
$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris Bioscience is the leading supplier of novel and exclusive
tools for
life science research with over 30 years' experience in the
industry.
Tocris is a Bio-Techne brand.