Protocadherin-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59272

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Protocadherin-8 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PCDH8(protocadherin 8) The peptide sequence was selected from the middle region of PCDH8. Peptide sequence GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Protocadherin-8 Antibody - BSA Free

Western Blot: Protocadherin-8 Antibody [NBP1-59272]

Western Blot: Protocadherin-8 Antibody [NBP1-59272]

Western Blot: PCDH8 Antibody [NBP1-59272] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for Protocadherin-8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Protocadherin-8

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails.

Alternate Names

Arcadlin, PAPC, PCDH8, Protocadherin8

Gene Symbol

PCDH8

UniProt

Q5TAN1 (Human)

Additional Protocadherin-8 Products

Product Documents for Protocadherin-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Protocadherin-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cadherin Superfamily

Customer Reviews for Protocadherin-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Protocadherin-8 Antibody - BSA Free and earn rewards!

Have you used Protocadherin-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies