PSTPIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85554

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all PSTPIP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of PSTPIP1. Peptide sequence: HIQLALTLREELRSLEEFRERQKEQRKKYEAVMDRVQKSKLSLYKKAMES The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for PSTPIP1 Antibody - BSA Free

Western Blot: PSTPIP1 Antibody [NBP2-85554]

Western Blot: PSTPIP1 Antibody [NBP2-85554]

Western Blot: PSTPIP1 Antibody [NBP2-85554] - WB Suggested Anti-PSTPIP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

Applications for PSTPIP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSTPIP1

The protein encoded by the PSTPIP1 gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome. (provided by RefSeq)

Alternate Names

CD2BP1CD2-binding protein 1, CD2BP1L, CD2BP1S, H-PIPPEST phosphatase-interacting protein 1, PAPASCD2 antigen-binding protein 1, proline-serine-threonine phosphatase interacting protein 1, proline-serine-threonine phosphatase-interacting protein 1, PSTPIPCD2 cytoplasmic tail-binding protein

Gene Symbol

PSTPIP1

Additional PSTPIP1 Products

Product Documents for PSTPIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSTPIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSTPIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSTPIP1 Antibody - BSA Free and earn rewards!

Have you used PSTPIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies