RAB34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85576

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB34 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human RAB34. Peptide sequence: FFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB34 Antibody - BSA Free

Western Blot: RAB34 Antibody [NBP2-85576]

Western Blot: RAB34 Antibody [NBP2-85576]

Western Blot: RAB34 Antibody [NBP2-85576] - RAB34 antibody - C-terminal region validated by WB using HepG2 cell lysate at 1ug/ml.
Western Blot: RAB34 Antibody [NBP2-85576]

Western Blot: RAB34 Antibody [NBP2-85576]

Western Blot: RAB34 Antibody [NBP2-85576] - Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug). 2. Monkey Fibroblast Cell Lysate (15ug). Primary Dilution: 1:1000. Secondary Antibody. : goat anti-Rabbit. Secondary Dilution: 1:40,000. Image Submitted by: Dr. Jakob Szwedo, Dr. Lupashin's Lab. University of Arkansas for Medical Sciences

Applications for RAB34 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB34

RAB proteins, like RAB34, are small GTPases that regulate vesicle budding, docking, and fusion along endocytosis and exocytosis pathways (Chen et al., 2003 [PubMed 12684051]).[supplied by OMIM]

Alternate Names

RAB34, member RAS oncogene family, RAHRAB39Ras-related protein Rab-39, ras-related protein Rab-34, Ras-related protein Rah

Gene Symbol

RAB34

Additional RAB34 Products

Product Documents for RAB34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB34 Antibody - BSA Free and earn rewards!

Have you used RAB34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies