RAB6A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88116

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RAB6A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RAB6A. Peptide sequence: ERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRSREDMIDI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAB6A Antibody - BSA Free

Western Blot: RAB6A Antibody [NBP2-88116]

Western Blot: RAB6A Antibody [NBP2-88116]

Western Blot: RAB6A Antibody [NBP2-88116] - Host: Rabbit. Target Name: RAB6A. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1.0ug/ml
Western Blot: RAB6A Antibody [NBP2-88116]

Western Blot: RAB6A Antibody [NBP2-88116]

Western Blot: RAB6A Antibody [NBP2-88116] - Host: Mouse. Target Name: RAB6A. Sample Tissue: Mouse Heart. Antibody Dilution: 1ug/ml

Applications for RAB6A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB6A

Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity

Alternate Names

GTP-binding protein RAB6A', GTP-binding protein RAB6B, Oncogene RAB6, Rab GTPase, Rab-6, RAB6, member RAS oncogene family, RAB6A', Rab6A variant 3, RAB6A, member RAS oncogene family, RAB6B, RAB6rab-6, ras-related protein Rab-6A

Gene Symbol

RAB6A

Additional RAB6A Products

Product Documents for RAB6A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAB6A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB6A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB6A Antibody - BSA Free and earn rewards!

Have you used RAB6A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies