RAP1GAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53072

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot, Simple Western

Cited:

Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAP1GAP Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RAP1GAP(RAP1 GTPase activating protein) The peptide sequence was selected from the middle region of RAP1GAP. Peptide sequence IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAP1GAP Antibody - BSA Free

Western Blot: RAP1GAP Antibody [NBP1-53072]

Western Blot: RAP1GAP Antibody [NBP1-53072]

Western Blot: RAP1GAP Antibody [NBP1-53072] - Human 721_B, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: RAP1GAP Antibody [NBP1-53072]

Western Blot: RAP1GAP Antibody [NBP1-53072]

Western Blot: RAP1GAP Antibody [NBP1-53072] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.
SDS-PAGE: RAP1GAP Antibody [NBP1-53072]

Western Blot: RAP1GAP Antibody [NBP1-53072]

Western Blot: RAP1GAP Antibody [NBP1-53072] - Human Hela, Antibody Dilution: 1.0 ug/ml RAP1GAP is supported by BioGPS gene expression data to be expressed in HeLa.

Applications for RAP1GAP Antibody - BSA Free

Application
Recommended Usage

Simple Western

1:10

Western Blot

1.0 ug/ml
Application Notes

See Simple Western Antibody Database for Simple Western validation: Tested in Brain, separated by Size, antibody dilution of 1:10

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAP1GAP

RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Alternate Names

GTPase activating protein 1, RAP1 GTPase activating protein

Gene Symbol

RAP1GAP

UniProt

P47736 (Human)

Additional RAP1GAP Products

Product Documents for RAP1GAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAP1GAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RAP1GAP Antibody - BSA Free

Customer Reviews for RAP1GAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAP1GAP Antibody - BSA Free and earn rewards!

Have you used RAP1GAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies