Rap2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98510

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rap2B Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is RAP2B - C-terminal region. Peptide sequence YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Rap2B Antibody - BSA Free

Western Blot: Rap2B Antibody [NBP1-98510]

Western Blot: Rap2B Antibody [NBP1-98510]

Western Blot: Rap2B Antibody [NBP1-98510] - Human Fetal liver Cell Lysate, concentration 1 ug/ml.

Applications for Rap2B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rap2B

This intronless gene belongs to a family of RAS-related genes. The proteins encoded by these genes share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between the RAP and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. Evidence suggests that this protein may be polyisoprenylated and palmitoylated.

Long Name

Ras-related Protein 2B

Alternate Names

MGC20484, RAP2B, member of RAS oncogene family, Ras family small GTP binding protein RAP2B, ras-related protein Rap-2b, small GTP binding protein

Gene Symbol

RAP2B

UniProt

NP_002877 (Human)

Additional Rap2B Products

Product Documents for Rap2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rap2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rap2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rap2B Antibody - BSA Free and earn rewards!

Have you used Rap2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies