RASL12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98570

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RASL12 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is Rasl12 - N-terminal region. Peptide sequence DPNLEDTYSSEETVDHQPVHLRVMDTADLDTPRNCERYLNWAHAFLVVYS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RASL12 Antibody - BSA Free

Western Blot: RASL12 Antibody [NBP1-98570]

Western Blot: RASL12 Antibody [NBP1-98570]

Western Blot: RASL12 Antibody [NBP1-98570] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Applications for RASL12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RASL12

Belonging to the small GTPase superfamily/Ras family, RASL12 is localized in the cellular membrane and cytoplasm. RASL12 has many important molecular functions including GTP binding, GTPase activity and nucleotide binding. The main biological function of this gene is to participate in the GTP catabolic process, signal transduction and small GTPase mediated signal transduction. RASL12 interacts with ACVR1, SMAD1, SMAD2, SMAD3 and SMURF2. Documented diseases associated with RASL12 include acute kidney tubular necrosis, intraepithelial neoplasm, retinitis, endometrial cancer, coronary artery disease and Huntington's disease.

Alternate Names

Ras family member Ris, ras-like protein family member 12, RAS-like, family 12, RISRas-like protein Ris

Gene Symbol

RASL12

UniProt

NP_001028330 (Mouse)

Additional RASL12 Products

Product Documents for RASL12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RASL12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RASL12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RASL12 Antibody - BSA Free and earn rewards!

Have you used RASL12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies