REEP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82335

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all REEP3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human REEP3. Peptide sequence: HDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for REEP3 Antibody - BSA Free

Western Blot: REEP3 Antibody [NBP2-82335]

Western Blot: REEP3 Antibody [NBP2-82335]

Western Blot: REEP3 Antibody [NBP2-82335] - WB Suggested Anti-REEP3 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole Cell

Applications for REEP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: REEP3

REEP3 may enhance the cell surface expression of odorant receptors

Alternate Names

C10orf74receptor expression enhancing protein 3, chromosome 10 open reading frame 74, MGC87479, receptor accessory protein 3, receptor expression-enhancing protein 3

Gene Symbol

REEP3

Additional REEP3 Products

Product Documents for REEP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for REEP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for REEP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review REEP3 Antibody - BSA Free and earn rewards!

Have you used REEP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies