Rffl Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55375

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rffl Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RFFL (ring finger and FYVE-like domain containing 1) The peptide sequence was selected from the middle region of RFFL)(50ug). Peptide sequence KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Rffl Antibody - BSA Free

Western Blot: Rffl Antibody [NBP1-55375]

Western Blot: Rffl Antibody [NBP1-55375]

Western Blot: Rffl Antibody [NBP1-55375] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Applications for Rffl Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rffl

RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. Has anti-apoptotic activity.RFFL may bind phosphatidylinositol phosphates.

Alternate Names

CARP-2, Caspase regulator CARP2, Caspases-8 and -10-associated RING finger protein 2, E3 ubiquitin-protein ligase rififylin, EC 6.3.2, EC 6.3.2.-, Fring, FYVE-RING finger protein Sakura, rififylin, ring finger and FYVE-like domain containing 1, RING finger and FYVE-like domain-containing protein 1, RING finger protein 189, RING finger protein 34-like, RNF189CARP2, RNF34LFRING

Gene Symbol

RFFL

UniProt

Q8WZ73 (Human)

Additional Rffl Products

Product Documents for Rffl Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rffl Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rffl Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rffl Antibody - BSA Free and earn rewards!

Have you used Rffl Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies