RGS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58312

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human RGS3 Peptide sequence KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to isoforms 1-4 and 6 of RGS3 (Uniprot: P49796).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RGS3 Antibody - BSA Free

Western Blot: RGS3 Antibody [NBP1-58312]

Western Blot: RGS3 Antibody [NBP1-58312]

Western Blot: RGS3 Antibody [NBP1-58312] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for RGS3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RGS3

RGS3 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.

Alternate Names

C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, regulator of G-protein signaling 3, regulator of G-protein signalling 3, RGP3

Entrez Gene IDs

5998 (Human)

Gene Symbol

RGS3

Additional RGS3 Products

Product Documents for RGS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RGS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RGS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RGS3 Antibody - BSA Free and earn rewards!

Have you used RGS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...