RNF130 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83454

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RNF130 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human RNF130. Peptide sequence: QEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RNF130 Antibody - BSA Free

Western Blot: RNF130 Antibody [NBP2-83454]

Western Blot: RNF130 Antibody [NBP2-83454]

Western Blot: RNF130 Antibody [NBP2-83454] - WB Suggested Anti-RNF130 Antibody Titration: 2.5ug/ml. Positive Control: Human Thymus
Western Blot: RNF130 Antibody [NBP2-83454]

Western Blot: RNF130 Antibody [NBP2-83454]

Western Blot: RNF130 Antibody [NBP2-83454] - Host: Rabbit. Target: RNF130. Positive control (+): Human Lung Tumor (T-LU). Negative control (-): Human Stomach Tumor (T-ST). Antibody concentration: 3ug/ml

Applications for RNF130 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RNF130

RNF130 - ring finger protein 130

Alternate Names

E3 ubiquitin-protein ligase RNF130, EC 2.1.1, EC 6.3.2, EC 6.3.2.-, g1-related zinc finger protein, G1RZFP, GOLIATH, Goliath homolog, GP, H-Goliath, MGC117241, MGC99542, ring finger protein 130MGC138647

Gene Symbol

RNF130

Additional RNF130 Products

Product Documents for RNF130 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF130 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RNF130 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RNF130 Antibody - BSA Free and earn rewards!

Have you used RNF130 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies