SCAMP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69192

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SCAMP3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SCAMP3 (secretory carrier membrane protein 3) The peptide sequence was selected from the N terminal of SCAMP3. Peptide sequence FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SCAMP3 Antibody - BSA Free

Western Blot: SCAMP3 Antibody [NBP1-69192]

Western Blot: SCAMP3 Antibody [NBP1-69192]

Western Blot: SCAMP3 Antibody [NBP1-69192] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Applications for SCAMP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCAMP3

This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Two transcript variants encoding different isoforms have been found for this gene.

Long Name

Secretory Carrier Membrane Protein 3

Alternate Names

PROPIN1

Gene Symbol

SCAMP3

UniProt

O14828-2 (Human)

Additional SCAMP3 Products

Product Documents for SCAMP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SCAMP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCAMP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCAMP3 Antibody - BSA Free and earn rewards!

Have you used SCAMP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies