Septin-2 Antibody (9N1B3)

Novus Biologicals | Catalog # NBP3-16653

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9N1B3 expressed in HEK293
View all Septin-2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 202-298 of human Septin-2 (Q15019). EIEEHNIKIYHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDLHYEN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Septin-2 Antibody (9N1B3)

Western Blot: Septin-2 Antibody (9N1B3) [NBP3-16653]

Western Blot: Septin-2 Antibody (9N1B3) [NBP3-16653]

Western Blot: Septin-2 Antibody (9N1B3) [NBP3-16653] - Western blot analysis of extracts of various cell lines, using Septin-2 Rabbit mAb (NBP3-16653) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Applications for Septin-2 Antibody (9N1B3)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Septin-2

Alternate Names

DIFF6NEDD-5, hNedd5, KIAA0158Neural precursor cell expressed developmentally down-regulated protein 5, NEDD5Pnutl3, neural precursor cell expressed, developmentally down-regulated 5, septin 2, septin-2

Gene Symbol

SEPTIN2

Additional Septin-2 Products

Product Documents for Septin-2 Antibody (9N1B3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Septin-2 Antibody (9N1B3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Septin-2 Antibody (9N1B3)

There are currently no reviews for this product. Be the first to review Septin-2 Antibody (9N1B3) and earn rewards!

Have you used Septin-2 Antibody (9N1B3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies