SKA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88277

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SKA1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of SKA1. Peptide sequence: LLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTAT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SKA1 Antibody - BSA Free

Western Blot: SKA1 Antibody [NBP2-88277]

Western Blot: SKA1 Antibody [NBP2-88277]

Western Blot: SKA1 Antibody [NBP2-88277] - WB Suggested Anti-Ska1 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Pancreas

Applications for SKA1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SKA1

SKA1 is a component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essentialfor proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolarattachment on spindle microtubu

Alternate Names

C18orf24, chromosome 18 open reading frame 24, MGC10200, spindle and kinetochore associated complex subunit 1, spindle and kinetochore-associated protein 1, spindle and KT (kinetochore) associated 1

Gene Symbol

SKA1

Additional SKA1 Products

Product Documents for SKA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SKA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SKA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SKA1 Antibody - BSA Free and earn rewards!

Have you used SKA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies