SLC34A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85748

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC34A1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of rat SLC34A1. Peptide sequence: YVPSPQVLHRIPGTTTYAISSLSPVALTEHSCPYGEVLECHDPLPAKLAQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC34A1 Antibody - BSA Free

Western Blot: SLC34A1 Antibody [NBP2-85748]

Western Blot: SLC34A1 Antibody [NBP2-85748]

Western Blot: SLC34A1 Antibody [NBP2-85748] - Host: Rabbit. Target Name: Slc34a1. Sample Type: Rat Thymus lysates. Antibody Dilution: 1.0ug/ml

Applications for SLC34A1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC34A1

The SLC34A1 gene encodes a member of the type II sodium-phosphate cotransporter family. Mutations in this gene are associated with hypophosphatemia nephrolithiasis/osteoporosis 1. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Alternate Names

FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, naPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1

Gene Symbol

SLC34A1

Additional SLC34A1 Products

Product Documents for SLC34A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC34A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC34A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC34A1 Antibody - BSA Free and earn rewards!

Have you used SLC34A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies