SLC35B2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83547

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SLC35B2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC35B2. Peptide sequence: LLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SLC35B2 Antibody - BSA Free

Western Blot: SLC35B2 Antibody [NBP2-83547]

Western Blot: SLC35B2 Antibody [NBP2-83547]

Western Blot: SLC35B2 Antibody [NBP2-83547] - Host: Rabbit. Target Name: SLC35B2. Sample Type: 786-0 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SLC35B2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC35B2

Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIM]

Alternate Names

adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, PAPST13'-phosphoadenosine 5'-phosphosulfate transporter, Putative MAPK-activating protein PM15, Putative NF-kappa-B-activating protein 48, SLL, Solute carrier family 35 member B2, solute carrier family 35 member B2 variant 2, solute carrier family 35, member B2, UGTrel4

Gene Symbol

SLC35B2

Additional SLC35B2 Products

Product Documents for SLC35B2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC35B2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC35B2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC35B2 Antibody - BSA Free and earn rewards!

Have you used SLC35B2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies