SMC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52932

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SMC2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SMC2 Antibody - BSA Free

Western Blot: SMC2 Antibody [NBP1-52932]

Western Blot: SMC2 Antibody [NBP1-52932]

Western Blot: SMC2 Antibody [NBP1-52932] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for SMC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMC2

SMC2 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Alternate Names

CAP-E, CAPESMC2 structural maintenance of chromosomes 2-like 1 (yeast), chromosome-associated protein E, FLJ10093, hCAP-EXCAP-E homolog, SMC protein 2, SMC-2, SMC2 (structural maintenance of chromosomes 2, yeast)-like 1, SMC2 structural maintenance of chromosomes 2-like 1, SMC2L1, structural maintenance of chromosomes (SMC) family member, structural maintenance of chromosomes 2, structural maintenance of chromosomes protein 2

Gene Symbol

SMC2

Additional SMC2 Products

Product Documents for SMC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SMC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMC2 Antibody - BSA Free and earn rewards!

Have you used SMC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies