SNX 482

  ( 6 citations )    
Product Datasheet
Catalog Number:2945
Chemical Name:
Product Details
Citations (6)
Reviews
Biological Activity
Potent and selective, voltage-dependent R-type CaV2.3 calcium channel blocker (IC50 = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.
Technical Data
  • M.Wt:
    4495.01
  • Formula:
    C192H274N52O60S7
  • Sequence:
    GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

    (Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)

  • Solubility:
    Soluble in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    203460-30-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for SNX 482 include:

6 Citations: Showing 1 - 6
Filter your results:

  1. Direct versus indirect actions of ghrelin on hypothalamic NPY neurons.
    Authors: Hashiguchi
    PLoS One  2017;12(9):e0184261
  2. σ-1 receptor antagonism restores injury-induced decrease of voltage-gated Ca2+ current in sensory neurons.
    Authors: Pan Et al.
    Proc Natl Acad Sci U S A  2014;350:290
  3. Fetal calcium regulates branching morphogenesis in the developing human and mouse lung: involvement of voltage-gated calcium channels.
    Authors: Brennan Et al.
    PLoS One  2013;8:e80294
  4. Miniature IPSCs in hippocampal granule cells are triggered by voltage-gated Ca2+ channels via microdomain coupling.
    Authors: Goswami Et al.
    J Neurosci  2012;32:14294
  5. Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability.
    Authors: Grubb and Burrone
    J Pharmacol Exp Ther  2010;465:1070
  6. Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors.
    Authors: Higley and Sabatini
    Nat Neurosci  2010;13:958

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used SNX 482?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee