Catalog Number: 2945
Biological Activity
Potent and selective, voltage-dependent R-type CaV2.3 calcium channel blocker (IC50 = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses.
Technical Data
  • M.Wt:
    4495.01
  • Formula:
    C192H274N52O60S7
  • Sequence:
    GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

    (Modifications: Disulfide bridge between 7 - 21, 14 - 26, 20 - 33)

  • Solubility:
    Soluble in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    203460-30-4
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas.
    Newcomb et al.
    Biochemistry, 1998;37:15353
  2. Interaction of SNX482 with domains III and IV inhibits activation gating of α1E (CaV2.3) calcium channels.
    Bourinet et al.
    Biophys.J., 2001;81:79
  3. The CaV2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain.
    Matthews et al.
    Eur.J.Neurosci., 2007;25:3561
Citations:

The citations listed below are publications that use Tocris products. Selected citations for SNX 482 include:

3 Citations: Showing 1 - 3
Filter your results:

  1. σ-1 receptor antagonism restores injury-induced decrease of voltage-gated Ca2+ current in sensory neurons.
    Authors: Pan Et al.
    Proc Natl Acad Sci U S A 2014;350:290
  2. Activity-dependent relocation of the axon initial segment fine-tunes neuronal excitability.
    Authors: Grubb and Burrone
    J Pharmacol Exp Ther 2010;465:1070
  3. Competitive regulation of synaptic Ca2+ influx by D2 dopamine and A2A adenosine receptors.
    Authors: Higley and Sabatini
    Nat Neurosci 2010;13:958

Have you used SNX 482?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information