SPANXC Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86825

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SPANXC Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of SPANXC. Peptide sequence: EVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SPANXC Antibody - BSA Free

Western Blot: SPANXC Antibody [NBP2-86825]

Western Blot: SPANXC Antibody [NBP2-86825]

Western Blot: SPANXC Antibody [NBP2-86825] - WB Suggested Anti-SPANXC Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole Cell

Applications for SPANXC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPANXC

Human Sperm Proteins Associated with the Nucleus on X-chromosome (SPANX) are relatively low molecular weight cytoplasmic proteins found in testis and sperm. Their expression in other tissues indicates malignancies. Family members are observed as proteins that range from 15 to 20 kDa.

Alternate Names

B1, C, cancer/testis antigen 11.3, cancer/testis antigen family 11, member 3, cancer/testis-associated protein CTp11, cancer/testis-associated protein of 11 kD, cancer-testis-associated protein CTp11, CT11.1, CT11.2, CT11.3, CT11.4, CTp11, dJ171K16.1, NAP-X, nuclear-associated protein SPAN-Xc, SPANX, SPANX family, member C, SPANXA, SPAN-Xa, SPANX-A, SPANXB, SPAN-Xb, SPANX-B, SPANX-C, SPAN-Xc protein, SPANX-D, sperm protein associated with the nucleus on the X chromosome C, sperm protein associated with the nucleus, X chromosome, family member C

Gene Symbol

SPANXC

Additional SPANXC Products

Product Documents for SPANXC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPANXC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPANXC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPANXC Antibody - BSA Free and earn rewards!

Have you used SPANXC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies