SYT11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69189

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SYT11 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence PPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SYT11 Antibody - BSA Free

Western Blot: SYT11 Antibody [NBP1-69189]

Western Blot: SYT11 Antibody [NBP1-69189]

Western Blot: SYT11 Antibody [NBP1-69189] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Applications for SYT11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SYT11

This gene is a member of the synaptotagmin gene family and encodes a protein similar to other family members that are known calcium sensors and mediate calcium-dependent regulation of membrane trafficking in synaptic transmission. The encoded protein is also a substrate for ubiquitin-E3-ligase parkin. The gene has previously been referred to as synaptotagmin XII but has been renamed synaptotagmin XI to be consistent with mouse and rat official nomenclature.

Alternate Names

DKFZp781D015, KIAA0080synaptotagmin 12, MGC10881, MGC17226, synaptotagmin XISYT12, synaptotagmin-11, SytXI

Gene Symbol

SYT11

UniProt

Q9BT88 (Human)

Additional SYT11 Products

Product Documents for SYT11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SYT11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SYT11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SYT11 Antibody - BSA Free and earn rewards!

Have you used SYT11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies