14-3-3 zeta/beta Antibody (7Z4S5)

Novus Biologicals | Catalog # NBP3-16770

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7Z4S5 expressed in HEK293
View all 14-3-3 zeta/beta Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 beta/zeta (P31946). MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 14-3-3 zeta/beta Antibody (7Z4S5)

Western Blot: 14-3-3 zeta/beta Antibody (7Z4S5) [NBP3-16770]

Western Blot: 14-3-3 zeta/beta Antibody (7Z4S5) [NBP3-16770]

Western Blot: 14-3-3 zeta/beta Antibody (7Z4S5) [NBP3-16770] - Western blot analysis of extracts of various cell lines, using 14-3-3 zeta/beta antibody (NBP3-16770) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Applications for 14-3-3 zeta/beta Antibody (7Z4S5)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: 14-3-3 zeta/beta

Alternate Names

KCIP-1MGC126532,14-3-3-zeta, MGC111427, MGC138156, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, deltapolypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zetapolypeptide, zeta polypeptide

Gene Symbol

YWHAZ

Additional 14-3-3 zeta/beta Products

Product Documents for 14-3-3 zeta/beta Antibody (7Z4S5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for 14-3-3 zeta/beta Antibody (7Z4S5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 14-3-3 zeta/beta Antibody (7Z4S5)

There are currently no reviews for this product. Be the first to review 14-3-3 zeta/beta Antibody (7Z4S5) and earn rewards!

Have you used 14-3-3 zeta/beta Antibody (7Z4S5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies