ABCG1 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-54682PEP
Key Product Details
Source
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-54682PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: ABCG1
A variety of cardiovascular and cardiometabolic diseases are associated with ABCG1 dysfunction (5-7). Macrophages can become cholesterol-containing foam cells that are generated by the uptake of low-density lipoproteins (LDL), cholesterol esterification, and compromised cholesterol efflux machinery in transporters like ABCG1 and ABCA1 (2, 5, 6, 7). Foam cells are associated with the chronic, inflammatory disease atherosclerosis which is characterized by arterial buildup of plaques that can ultimately lead to cardiovascular disease (5, 6, 7). Additionally, ABCG1 has a critical role in cardiometabolic disorders. Studies have found that diabetic mice have decreased ABCG1 expression (8). Furthermore, loss of ABCG1 in mouse pancreatic beta cells ultimately leads to impaired insulin secretion, suggesting that inhibition or modulation of ABCG1 may contribute to development of diabetes and obesity (8). Finally, other related ATP-binding cassette transporter family members, such as ABCA1 and ABCG5/8, have been associated with genetically-inherited syndromes like Tangier disease, characterized by reduced levels of HDL in the blood, and Sitosterolemia, characterized by elevated plant sterol lipid accumulation in blood and tissues (7)..
Alternate names for ABCG1 includes ABC transporter 8 (ABC8), ATP-binding cassette transporter, anti-, sub-family G (WHITE), homolog of Drosophila white, and MGC34313..
References
1. Tarling E. J. (2013). Expanding roles of ABCG1 and sterol transport. Current opinion in lipidology. https://doi.org/10.1097/MOL.0b013e32835da122.
2. Tarr, P. T., Tarling, E. J., Bojanic, D. D., Edwards, P. A., & Baldan, A. (2009). Emerging new paradigms for ABCG transporters. Biochimica et biophysica acta.https://doi.org/10.1016/j.bbalip.2009.01.007.
3. Tarling, E. J., & Edwards, P. A. (2011). ATP binding cassette transporter G1 (ABCG1) is an intracellular sterol transporter. Proceedings of the National Academy of Sciences of the United States of America. https://doi.org/10.1073/pnas.1113021108.
4. Phillips M. C. (2014). Molecular mechanisms of cellular cholesterol efflux. The Journal of biological chemistry, 289(35), 24020-24029. https://doi.org/10.1074/jbc.R114.583658.
5. Ouimet, M., Barrett, T. J., & Fisher, E. A. (2019). HDL and Reverse Cholesterol Transport. Circulation research. https://doi.org/10.1161/CIRCRESAHA.119.312617.
6. Yu, X. H., Fu, Y. C., Zhang, D. W., Yin, K., & Tang, C. K. (2013). Foam cells in atherosclerosis. Clinica chimica acta; international journal of clinical chemistry. https://doi.org/10.1016/j.cca.2013.06.006
Long Name
Alternate Names
Gene Symbol
Additional ABCG1 Products
Product Documents for ABCG1 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ABCG1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for ABCG1 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review ABCG1 Recombinant Protein Antigen and earn rewards!
Have you used ABCG1 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review