Acetyl CoA synthetase Antibody (4N5V4)

Novus Biologicals | Catalog # NBP3-15447

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4N5V4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Acetyl CoA synthetase (Q9NR19). LHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Acetyl CoA synthetase Antibody (4N5V4)

Western Blot: Acetyl CoA synthetase Antibody (4N5V4) [NBP3-15447]

Western Blot: Acetyl CoA synthetase Antibody (4N5V4) [NBP3-15447]

Western Blot: Acetyl CoA synthetase Antibody (4N5V4) [NBP3-15447] - Western blot analysis of extracts of various cell lines, using Acetyl CoA synthetase Rabbit mAb (NBP3-15447) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Western Blot: Acetyl CoA synthetase Antibody (4N5V4) [NBP3-15447]

Western Blot: Acetyl CoA synthetase Antibody (4N5V4) [NBP3-15447]

Western Blot: Acetyl CoA synthetase Antibody (4N5V4) [NBP3-15447] - Western blot analysis of extracts of HepG2 cells, using Acetyl CoA synthetase Rabbit mAb (NBP3-15447) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Acetyl CoA synthetase Antibody (4N5V4)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Acetyl CoA synthetase

Acetyl CoA synthetase encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

ACAS2, AceCS, acetate thiokinase, acetate-CoA ligase, Acetate--CoA ligase, Acetyl-CoA synthetase, acetyl-Coenzyme A synthetase 2 (ADP forming), acetyl-coenzyme A synthetase, cytoplasmic, ACSA, ACSACECS, Acyl-activating enzyme, acyl-CoA synthetase short-chain family member 2EC 6.2.1.1, cytoplasmic acetyl-coenzyme A synthetase, dJ1161H23.1, DKFZp762G026, EC 6.2.1

Gene Symbol

ACSS2

Additional Acetyl CoA synthetase Products

Product Documents for Acetyl CoA synthetase Antibody (4N5V4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acetyl CoA synthetase Antibody (4N5V4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Acetyl CoA synthetase Antibody (4N5V4)

There are currently no reviews for this product. Be the first to review Acetyl CoA synthetase Antibody (4N5V4) and earn rewards!

Have you used Acetyl CoA synthetase Antibody (4N5V4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...