Adenosylhomocysteinase/AHCY Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-55016
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to AHCY(S-adenosylhomocysteine hydrolase) The peptide sequence was selected from the N terminal of AHCY. Peptide sequence SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for Adenosylhomocysteinase/AHCY Antibody - BSA Free
Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP1-55016]
Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP1-55016] - Human Liver cell lysate, concentration 0.2-1 ug/ml.Western Blot: Adenosylhomocysteinase/AHCY Antibody - BSA Free [NBP1-55016] -
C1 metabolic pathway and characterization of R6/2 mice. A Folate, Met and BH4 cycles in plants and animals and their associated metabolism. Red lines stand for mammal specific, green lines stand for plant specific while black lines stand for both. All enzymes with protein levels examined by immunoblotting are marked in red. B mHtt protein aggregates in cortex and striatum regions were detected with anti-Htt antibody (mEM48) in 4-week-old male R6/2 and NCAR mice. C, D Quantification analysis of immunoblotting results of GTPCH, DHFR, QDPR, MS, MAT1/2A, AHCY, MTHFR, TPH2, TH, nNOS and ChAT (n = 7). The band intensity of each protein from western blotting D was normalized with gamma -tubulin on the same blot. The ratio was further calculated against NCAR whose relative expression level was set as 1. All data plotted are the average (n = 7) +/- SD. Only one representative western blotting of gamma -tubulin is shown. Original blots of above proteins before cropping are presented in Fig. S11. E Contents of BH4 and BH2, and their ratio in brain tissues and plasma (n = 4, average +/- SD). *p < 0.05; **p < 0.01. ***p < 0.001. Abbreviations used for enzymes: AHCYS-adenosylhomocysteine hydrolase, ChAT choline acetyltransferase, DHFR dihydrofolate reductase, GTPCH GTP cyclohydrolase I, MAT1/2A methionine adenosyltransferase, MS methionine synthase, MTHFR methylene-tetrahydrofolate reductase, nNOS neuronal nitric oxide synthase, QDPR quinoid dihydropteridine reductase, TH tyrosine hydroxylase (Tyr), TPH2 tryptophan hydroxylase Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36251090), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Adenosylhomocysteinase/AHCY Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Adenosylhomocysteinase/AHCY
Additional Adenosylhomocysteinase/AHCY Products
Product Documents for Adenosylhomocysteinase/AHCY Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Adenosylhomocysteinase/AHCY Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Adenosylhomocysteinase/AHCY Antibody - BSA Free
Customer Reviews for Adenosylhomocysteinase/AHCY Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Adenosylhomocysteinase/AHCY Antibody - BSA Free and earn rewards!
Have you used Adenosylhomocysteinase/AHCY Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...