Adenosylhomocysteinase/AHCY Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55016

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to AHCY(S-adenosylhomocysteine hydrolase) The peptide sequence was selected from the N terminal of AHCY. Peptide sequence SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Adenosylhomocysteinase/AHCY Antibody - BSA Free

Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP1-55016]

Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP1-55016]

Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP1-55016] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Adenosylhomocysteinase/AHCY Antibody - BSA Free

Western Blot: Adenosylhomocysteinase/AHCY Antibody - BSA Free [NBP1-55016] -

C1 metabolic pathway and characterization of R6/2 mice. A Folate, Met and BH4 cycles in plants and animals and their associated metabolism. Red lines stand for mammal specific, green lines stand for plant specific while black lines stand for both. All enzymes with protein levels examined by immunoblotting are marked in red. B mHtt protein aggregates in cortex and striatum regions were detected with anti-Htt antibody (mEM48) in 4-week-old male R6/2 and NCAR mice. C, D Quantification analysis of immunoblotting results of GTPCH, DHFR, QDPR, MS, MAT1/2A, AHCY, MTHFR, TPH2, TH, nNOS and ChAT (n = 7). The band intensity of each protein from western blotting D was normalized with gamma -tubulin on the same blot. The ratio was further calculated against NCAR whose relative expression level was set as 1. All data plotted are the average (n = 7) +/- SD. Only one representative western blotting of gamma -tubulin is shown. Original blots of above proteins before cropping are presented in Fig. S11. E Contents of BH4 and BH2, and their ratio in brain tissues and plasma (n = 4, average +/- SD). *p < 0.05; **p < 0.01. ***p < 0.001. Abbreviations used for enzymes: AHCYS-adenosylhomocysteine hydrolase, ChAT choline acetyltransferase, DHFR dihydrofolate reductase, GTPCH GTP cyclohydrolase I, MAT1/2A methionine adenosyltransferase, MS methionine synthase, MTHFR methylene-tetrahydrofolate reductase, nNOS neuronal nitric oxide synthase, QDPR quinoid dihydropteridine reductase, TH tyrosine hydroxylase (Tyr), TPH2 tryptophan hydroxylase Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36251090), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Adenosylhomocysteinase/AHCY Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenosylhomocysteinase/AHCY

S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family.S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

AdoHcyase, AHCY, SAHH

Gene Symbol

AHCY

UniProt

Additional Adenosylhomocysteinase/AHCY Products

Product Documents for Adenosylhomocysteinase/AHCY Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Adenosylhomocysteinase/AHCY Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Adenosylhomocysteinase/AHCY Antibody - BSA Free

Customer Reviews for Adenosylhomocysteinase/AHCY Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenosylhomocysteinase/AHCY Antibody - BSA Free and earn rewards!

Have you used Adenosylhomocysteinase/AHCY Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...