Adenylate Cyclase 6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59023

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Adenylate Cyclase 6 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ADCY6(adenylate cyclase 6) The peptide sequence was selected from the C terminal of ADCY6 (NP_066193). Peptide sequence LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

125 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Adenylate Cyclase 6 Antibody - BSA Free

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023] - Sample Tissue: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023]

Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023] - Hela cell lysate, concentration 0.2-1 ug/ml.

Applications for Adenylate Cyclase 6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Adenylate Cyclase 6

ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of this gene is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue. Alternative splicing generates 2 transcript variants.

Long Name

Adenylate cyclase type 6

Alternate Names

ADCY6, Adenylyl cyclase 6, KIAA0422

Entrez Gene IDs

112 (Human)

Gene Symbol

ADCY6

UniProt

O43306 (Human)

Additional Adenylate Cyclase 6 Products

Product Documents for Adenylate Cyclase 6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adenylate Cyclase 6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Adenylate Cyclase 6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Adenylate Cyclase 6 Antibody - BSA Free and earn rewards!

Have you used Adenylate Cyclase 6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies