AIPL1 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-55506PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AIPL1.

Source: E. coli

Amino Acid Sequence: AEVWNEAEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEPPAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55506.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-55506PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AIPL1

Leber congenital amaurosis (LCA) accounts for at least 5% of all inherited retinal disease and is the most severe inherited retinopathy with the earliest age of onset. Individuals affected with LCA are diagnosed at birth or in the first few months of life with severely impaired vision or blindness, nystagmus and an abnormal or flat electroretinogram. The photoreceptor/pineal -expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, was mapped within the LCA4 candidate region. The protein contains three tetratricopeptide motifs, consistent with nuclear transport or chaperone activity. AIPL1 mutations may cause approximately 20% of recessive LCA. [provided by RefSeq]

Alternate Names

AIPL2, aryl hydrocarbon receptor interacting protein-like 1, aryl hydrocarbon receptor-interacting protein-like 1, aryl-hydrocarbon-interacting protein-like 1, LCA4

Gene Symbol

AIPL1

Additional AIPL1 Products

Product Documents for AIPL1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AIPL1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for AIPL1 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review AIPL1 Recombinant Protein Antigen and earn rewards!

Have you used AIPL1 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for AIPL1 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: For my project I'm interested in an primary antibody that is not currently available on the market. The protein I'm interested in is aryl hydrocarbon receptor interacting protein. I would like to use the antibody for Western Blot and/or Immunoprecipitation, and this antibody has to be specific for a zebra fish protein. I would like to ask for a price quote.

    A:

    We currently have no AIPL1 antibodies validated in Zebra fish. If you are interested in testing in Zebra fish, you would qualify for our Innovators Reward Program. You may also contact us at innovators@novusbio.com should you have any questions about the Innovators Reward Program.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...