AKT1/2/3 Inhibitor Peptide Set
Novus Biologicals | Catalog # NBP2-29332
Loading...
Key Product Details
Species
Human
Loading...
Product Specifications
Specificity
The Akt (Isoforms 1,2,3) inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.
The control peptide consists of only the PTD sequence.
The control peptide consists of only the PTD sequence.
Application Notes
Inhibition of Akt kinase activity.
The inhibitor peptide is to block Akt1, Akt2, and Akt3 kinase activity. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.
Please refer to Hiromura et al (2004) for additional information about how the inhibitor peptide has been used to block Ak1, Akt2 and Akt3 kinase activity.
The inhibitor peptide is to block Akt1, Akt2, and Akt3 kinase activity. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.
Please refer to Hiromura et al (2004) for additional information about how the inhibitor peptide has been used to block Ak1, Akt2 and Akt3 kinase activity.
Inhibitor Content
Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214.
Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Formulation, Preparation, and Storage
Preparation Method
Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions.
Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. Akt (Isoforms 1,2,3) Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF Add 47.6 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving
Please contact technical support for detailed reconstitution instructions.
PBS* is added directly to the vials to prepare the stock solutions.
Note: Bring the solution to room temperature and quick spin the tubes before opening the caps. Akt (Isoforms 1,2,3) Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF Add 47.6 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.
Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving
Please contact technical support for detailed reconstitution instructions.
Formulation
Solubilize the peptides prior to use by making 5 mM PBS* stock solutions (please see Preparation of 5 mM Stock Solutions under Preparation Method).
Concentration
Lyoph
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: AKT1/2/3
Alternate Names
AKT, EC 2.7.11, EC 2.7.11.1, PKBMGC99656, PRKBA, Protein kinase B, Proto-oncogene c-Akt, rac protein kinase alpha, RAC-ALPHA, RAC-alpha serine/threonine-protein kinase, RAC-PK-alpha, RACPKB-ALPHA, v-akt murine thymoma viral oncogene homolog 1
Gene Symbol
AKT1
Additional AKT1/2/3 Products
Product Documents for AKT1/2/3 Inhibitor Peptide Set
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for AKT1/2/3 Inhibitor Peptide Set
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Inhibitors are guaranteed for 1 year from date of receipt.
Citations for AKT1/2/3 Inhibitor Peptide Set
Customer Reviews for AKT1/2/3 Inhibitor Peptide Set (1)
4 out of 5
1 Customer Rating
Have you used AKT1/2/3 Inhibitor Peptide Set?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Cell lysate from HeLa cellsSpecies: HumanVerified Customer | Posted 12/12/2014Western blot for HeLa cells
There are no reviews that match your criteria.
Protocols
View specific protocols for AKT1/2/3 Inhibitor Peptide Set (NBP2-29332):
AKT1/2/3 Inhibitor Peptide Set:
Hazard Information
Chemical Name: Non hazardous products
Chemical Formula: N/A
CAS Number: N/A
EEC-No: N/A
Hazard Identification
None
First Aid Measures
Eye Contact: None
Skin Contact: None
Inhalation: None
Ingestion: None
Accidental Release Measures
This product either does not contain hazardous constituents or the concentration of all chemical constituents are below the regulatory threshold limits described by Occupational Safety Health Administration Hazard Communication Standard 29 CFR 1910.1200 and the European Directive 91/155/EEC. 88/379/EEC, and 67/546/EEC.
Handling and Storage
Exposure Controls / Personal Protection
Other Precautions: None
Physical and Chemical Properties
Form: N/A
Color: N/A
Odor: N/A
Melting Point: N/A
Boiling Temperature: N/A
Density: N/A
Vapor Pressure: N/A
Solubility in Water: N/A
Flash Point: N/A
Explosion limits: N/A
Ignition Temperature: N/A
Hazard Information
Chemical Name: Non hazardous products
Chemical Formula: N/A
CAS Number: N/A
EEC-No: N/A
Hazard Identification
None
First Aid Measures
Eye Contact: None
Skin Contact: None
Inhalation: None
Ingestion: None
Accidental Release Measures
This product either does not contain hazardous constituents or the concentration of all chemical constituents are below the regulatory threshold limits described by Occupational Safety Health Administration Hazard Communication Standard 29 CFR 1910.1200 and the European Directive 91/155/EEC. 88/379/EEC, and 67/546/EEC.
Handling and Storage
Exposure Controls / Personal Protection
Other Precautions: None
Physical and Chemical Properties
Form: N/A
Color: N/A
Odor: N/A
Melting Point: N/A
Boiling Temperature: N/A
Density: N/A
Vapor Pressure: N/A
Solubility in Water: N/A
Flash Point: N/A
Explosion limits: N/A
Ignition Temperature: N/A
Loading...