ALG9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82591

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ALG9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ALG9. Peptide sequence: LLVLPLTSLMEYLLQRFHVQNLGHPYWLTLAPMYIWFIIFFIQPHKEERF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ALG9 Antibody - BSA Free

Western Blot: ALG9 Antibody [NBP2-82591]

Western Blot: ALG9 Antibody [NBP2-82591]

Western Blot: ALG9 Antibody [NBP2-82591] - Host: Rabbit. Target Name: ALG9. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for ALG9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ALG9

The ALG9 gene encodes an alpha-1,2-mannosyltransferase enzyme that functions in lipid-linked oligosaccharide assembly. Mutations in this gene result in congenital disorder of glycosylation type Il. Multiple transcript variants encoding different isoforms have

Alternate Names

alpha-1,2-mannosyltransferase ALG9, asparagine-linked glycosylation 9 homolog (S. cerevisiae, alpha-1,2-mannosyltransferase), asparagine-linked glycosylation 9 homolog (yeast, alpha 1,2mannosyltransferase), asparagine-linked glycosylation 9 homolog (yeast, alpha-1,2-mannosyltransferase), asparagine-linked glycosylation 9, alpha- 1,2-mannosyltransferase homolog (S.cerevisiae, alpha- 1,2-mannosyltransferase), asparagine-linked glycosylation 9, alpha-1,2-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 9 homolog, CDG1L, DIBD1FLJ21845, disrupted in bipolar affective disorder 1, Disrupted in bipolar disorder protein 1, DKFZp586M2420, EC 2.4.1.-, LOH11CR1J, loss of heterozygosity, 11, chromosomal region 1 gene J product

Gene Symbol

ALG9

Additional ALG9 Products

Product Documents for ALG9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ALG9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ALG9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ALG9 Antibody - BSA Free and earn rewards!

Have you used ALG9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies