alpha 1B-Glycoprotein Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-57965
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to A1BG (alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG. Peptide sequence MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for alpha 1B-Glycoprotein Antibody - BSA Free
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Reccomended Titration: 1.25 ug/mlPositive Control: HepG2 Whole Cell ACAT2 is supported by BioGPS gene expression data to be expressed in HepG2Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Fetal Liver tissue lysate at a concentration of 0.1ug/ml.Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Sample Type: HepG2 Antibody Dilution: 1.0 ug/ml ACAT2 is supported by BioGPS gene expression data to be expressed in HepG2Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Sample Type: 721_B Antibody Dilution: 1.0 ug/ml ACAT2 is supported by BioGPS gene expression data to be expressed in 721_BWestern Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965]
Western Blot: alpha 1B-Glycoprotein Antibody [NBP1-57965] - Reccomended Titration: 5 ug/ml Positive Control: human liver, human serum, human plasmaApplications for alpha 1B-Glycoprotein Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: alpha 1B-Glycoprotein
Additional alpha 1B-Glycoprotein Products
Product Documents for alpha 1B-Glycoprotein Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for alpha 1B-Glycoprotein Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for alpha 1B-Glycoprotein Antibody - BSA Free
There are currently no reviews for this product. Be the first to review alpha 1B-Glycoprotein Antibody - BSA Free and earn rewards!
Have you used alpha 1B-Glycoprotein Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...