Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein

Novus Biologicals | Catalog # NBP3-14774

Novus Biologicals
Loading...

Key Product Details

Applications

Western Blot, Functional Assay, Microscopy, SDS-PAGE
Loading...

Product Specifications

Description

A full length recombinant protein of Rat alpha-Synuclein

Source: E. coli

Uniprot ID: P37377

Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDP SSEAYEMPSEEGYQDYEPEA

Purity

>95%, by SDS-PAGE

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein

In vitro assay: Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein [NBP3-14774]

In vitro assay: Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein [NBP3-14774]

In vitro assay: Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein [NBP3-14774] - Thioflavin T is a fluorescent dye that binds to beta sheet-rich structures, such as those in alpha synuclein monomers and fibrils. Upon binding, the emission spectrum of the dye experiences a red-shift, and increased fluorescence intensity. The Rat alpha-Synuclein monomer is very active and was able to form more beta-sheet structure alone than with the combination of monomer and fibril. In combination, the fibril (NBP3-14774) is the majority of the seed.
Electron Microscopy: Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein [NBP3-14774] - TEM of Rat alpha-Synuclein Pre-formed Fibrils (PFFS) (NBP3-14774). 500nm
Electron Microscopy: Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein [NBP3-14774] - TEM of Rat alpha-Synuclein Pre-formed Fibrils (PFFS) (NBP3-14774). 200nm

Formulation, Preparation, and Storage

NBP3-14774
Preparation Method Ion-exchange Purified
Formulation PBS pH 7.4
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: alpha-Synuclein

Alpha-synuclein, a member of the synuclein family, is a protein that was first identified in 1988 whose name is derived from its localization to both the synapse and nucleus (1-3). Specifically, it is expressed primarily in the brain, including Lewy Bodies (1-6). Alpha-synuclein is encoded by the SNCA gene, located on chromosome 4p21, and is processed as a 140 amino acid (aa) protein with a theoretical molecular weight of 14 kDa (1,2,4). Structurally alpha-synuclein consists of a N-terminal binding domain (1-60 aa), a central domain core region called the non-amyloid-beta component (NAC) (61-95 aa), and a C-terminal domain (96-140 aa) (1-3). The N-terminal region contains aa repeats with a KTKEGV consensus sequence that gives the protein its alpha-helical structure that associates with lipid membranes (1-4). The hydrophobic NAC region is responsible for alpha-synuclein aggregation and fibril formation (1-4). The acidic C-terminal tail is largely unstructured but can be targeted for post-translational modifications (1-4). The function of alpha-synuclein is not entirely understood, but it is shown to have a role in suppression of apoptosis, acting as a molecular chaperone, regulating glucose, and modulating calmodulin activity (1,3).

A number of studies have revealed that alpha-synuclein aggregation is a hallmark feature in a number of neurodegenerative diseases, referred to as synucleinopathies (2-4). Alpha-synuclein protein aggregates are a large component of Lewy bodies that are present in Parkinson's disease (PD), Lewy body dementia (LBD), and multiple system atrophy (1-6). Research has shown phosphorylation of alpha-synuclein at Ser129 moves the protein from the nucleus to the cytoplasm and promotes fibril formation associated with synucleinopathies (1,2,5). Recent studies also suggest that alpha-synuclein accumulation can prevent mitochondrial import machinery causing mitochondrial dysfunction that is often observed in neurodegeneration (5). It is thought that preventing alpha-synuclein aggregation may prevent PD, thus alpha-synuclein is a target for many potential therapeutic interventions aimed at decreasing aggregate formation or increasing clearance (1,2,4-6).

References

1. Villar-Pique, A., Lopes da Fonseca, T., & Outeiro, T. F. (2016). Structure, function and toxicity of alpha-synuclein: the Bermuda triangle in synucleinopathies. Journal of neurochemistry. https://doi.org/10.1111/jnc.13249

2. Emamzadeh F. N. (2016). Alpha-synuclein structure, functions, and interactions. Journal of research in medical sciences : the official journal of Isfahan University of Medical Sciences. https://doi.org/10.4103/1735-1995.181989

3. Burre J. (2015). The Synaptic Function of alpha-Synuclein. Journal of Parkinson's disease. https://doi.org/10.3233/JPD-150642

4. Lashuel, H. A., Overk, C. R., Oueslati, A., & Masliah, E. (2013). The many faces of alpha-synuclein: from structure and toxicity to therapeutic target. Nature reviews. Neuroscience. https://doi.org/10.1038/nrn3406

5. Rocha, E. M., De Miranda, B., & Sanders, L. H. (2018). Alpha-synuclein: Pathology, mitochondrial dysfunction and neuroinflammation in Parkinson's disease. Neurobiology of disease. https://doi.org/10.1016/j.nbd.2017.04.004

6. O'Leary, E. I., & Lee, J. C. (2019). Interplay between alpha-synuclein amyloid formation and membrane structure. Biochimica et biophysica acta. Proteins and proteomics. https://doi.org/10.1016/j.bbapap.2018.09.012

Alternate Names

NACP, PARK1, PARK4, SNCA, Synuclein-alpha

Gene Symbol

SNCA

Additional alpha-Synuclein Products

Product Documents for Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein

Please note that the 200ug and 500ug sizes are sent in 2x100ug and 5x100ug vials, respectively

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein

There are currently no reviews for this product. Be the first to review Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein and earn rewards!

Have you used Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Rat alpha-Synuclein Active, Pre-formed Fibrils Protein

Showing  1 - 11 FAQ Showing All
  • Q: I'm looking for an alpha-Synuclein antibody with an epitope located in the first half (N-terminus) of the protein - preferably a monoclonal antibody. Can you help me with that?

    A:

    Please take a look at NB110-57475. It has been validated for human, rat and mouse and the applications ICC and WB and the epitope it detects is in the N terminal.

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...