Amylin Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00003375-D01P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

IAPP (NP_000406.1, 1 a.a. - 89 a.a.) full-length human protein. MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Specificity

Reacts with islet amyloid polypeptide.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian tissue lysate.

Scientific Data Images for Amylin Antibody - Azide and BSA Free

Western Blot: Amylin Antibody [H00003375-D01P]

Western Blot: Amylin Antibody [H00003375-D01P]

Western Blot: Amylin Antibody [H00003375-D01P] - Analysis of IAPP expression in human spleen.

Applications for Amylin Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against transfected lysate and as a detection antibody in ELISA.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Amylin

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq]

Alternate Names

AMYLIN, DAPamylin, Diabetes-associated peptide, IAP, Insulinoma amyloid peptide, islet amyloid polypeptide, Islet amyloid polypeptide (diabetes-associated peptide; amylin)

Entrez Gene IDs

3375 (Human)

Gene Symbol

IAPP

Additional Amylin Products

Product Documents for Amylin Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Amylin Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Amylin Antibody - Azide and BSA Free

Customer Reviews for Amylin Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Amylin Antibody - Azide and BSA Free and earn rewards!

Have you used Amylin Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Amylin Antibody - Azide and BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: I am trying to detect Human amylin/Human Amylin Oligomer expressed in tissues of Human amylin transgenic mice via Western blot and immunohistochemistry. I have found 3 antibodies from your website that may be suitable for the work. Amylin Antibody (NBP1-74545), Amylin Antibody (NBP1-69210), and Amylin Antibody (H00003375-D01P). I am just wondering if you could recommend one or two that maybe best suited for work I planned to do? The antibody should be specifically for human and does not cross react with mouse or rat.

    A: The peptide for NBP1-69210 shares 69% similarity with mouse so it probably won't cross-react but we can not guarantee that. H00003375-D01P is generated against the full-length protein which shares 66% similarity with mouse. Chances are neither of these will cross-react but they haven't been specifically tested for this so we can not guarantee it at this time. These two would be your best be to try.

  • Q: I was wondering if you knew/could find out the Kd (dissociation) of this Ab to human Amylin?

    A: Our lab has informed me that the dissociation constant for this Ab and its antigen has not been tested.

  • Q: I am trying to detect Human amylin/Human Amylin Oligomer expressed in tissues of Human amylin transgenic mice via Western blot and immunohistochemistry. I have found 3 antibodies from your website that may be suitable for the work. Amylin Antibody (NBP1-74545), Amylin Antibody (NBP1-69210), and Amylin Antibody (H00003375-D01P). I am just wondering if you could recommend one or two that maybe best suited for work I planned to do? The antibody should be specifically for human and does not cross react with mouse or rat.

    A: The peptide for NBP1-69210 shares 69% similarity with mouse so it probably won't cross-react but we can not guarantee that. H00003375-D01P is generated against the full-length protein which shares 66% similarity with mouse. Chances are neither of these will cross-react but they haven't been specifically tested for this so we can not guarantee it at this time. These two would be your best be to try.

  • Q: I was wondering if you knew/could find out the Kd (dissociation) of this Ab to human Amylin?

    A: Our lab has informed me that the dissociation constant for this Ab and its antigen has not been tested.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...