Ancient ubiquitous protein 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10648

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ancient ubiquitous protein 1 (NP_031543). Peptide sequence MPKDSAFPGAPAALRRWRRQRPRSPEAAAMEPPPAPGPERLFDSHRLPSD

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ancient ubiquitous protein 1 Antibody - BSA Free

Western Blot: Ancient ubiquitous protein 1 Antibody [NBP3-10648]

Western Blot: Ancient ubiquitous protein 1 Antibody [NBP3-10648]

Western Blot: Ancient ubiquitous protein 1 Antibody [NBP3-10648] - Western blot analysis of Ancient ubiquitous protein 1 in Mouse Heart lysates. Antibody dilution at 1.0ug/ml

Applications for Ancient ubiquitous protein 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Ancient ubiquitous protein 1

Ancient ubiquitous protein 1 encodes a protein that contains a domain with homology to the ancient conserved region of the archain 1 gene and a domain that may be involved in binding ubiquitin-conjugating enzymes. The protein encoded by this gene has been shown to bind to the conserved membrane-proximal sequence of the cytoplasmic tail of integrin alpha(IIb) subunits. These subunits play a crucial role in the integrin alpha(IIb)beta(3) inside-out signaling in platelets and megakaryocytes that leads to platelet aggregation and thrombus formation. This gene overlaps the gene for mitochondrial serine protease 25.

Alternate Names

ancient ubiquitous protein 1

Gene Symbol

AUP1

Additional Ancient ubiquitous protein 1 Products

Product Documents for Ancient ubiquitous protein 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ancient ubiquitous protein 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Ancient ubiquitous protein 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ancient ubiquitous protein 1 Antibody - BSA Free and earn rewards!

Have you used Ancient ubiquitous protein 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...