ANKS1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10687

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ANKS1B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKS1B (NP_858056). Peptide sequence PSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ANKS1B Antibody - BSA Free

Western Blot: ANKS1B Antibody [NBP3-10687]

Western Blot: ANKS1B Antibody [NBP3-10687]

Western Blot: ANKS1B Antibody [NBP3-10687] - Western blot analysis of ANKS1B in HepG2 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Applications for ANKS1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ANKS1B

Isoform 2 may participate in the regulation of nucleoplasmic coilin protein interactions in neuronal andtransformed cells.Isoform 3 can regulate global protein synthesis by altering nucleolar numbers.Isoform 4 may play a role as a modulator of APP processing. Overexpression can down-regulate APP processing

Alternate Names

AIDA-1AIDA, amyloid-beta precursor protein intracellular domain associated protein 1, Amyloid-beta protein intracellular domain-associated protein 1, ANKS2, ankyrin repeat and sterile alpha motif domain containing 1B, ankyrin repeat and sterile alpha motif domain-containing protein 1B, cajalin 2, cajalin-2, E2A-PBX1-associated protein, EB1, EB-1MGC26087

Gene Symbol

ANKS1B

Additional ANKS1B Products

Product Documents for ANKS1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ANKS1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ANKS1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ANKS1B Antibody - BSA Free and earn rewards!

Have you used ANKS1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies