APMAP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59984

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to C20ORF3 The peptide sequence was selected from the C terminal of C20ORF3 (NP_065392). Peptide sequence QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for APMAP Antibody - BSA Free

Western Blot: APMAP Antibody [NBP1-59984]

Western Blot: APMAP Antibody [NBP1-59984]

Western Blot: APMAP Antibody [NBP1-59984] - HepG2 cell lysate, concentration 1.25ug/ml.

Applications for APMAP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APMAP

C20orf3 may play a role in adipocyte differentiation.

Alternate Names

adipocyte plasma membrane-associated protein, APMAP, BSCv, chromosome 20 open reading frame 3, Protein BSCv

Entrez Gene IDs

57136 (Human)

Gene Symbol

APMAP

UniProt

Additional APMAP Products

Product Documents for APMAP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for APMAP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APMAP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review APMAP Antibody - BSA Free and earn rewards!

Have you used APMAP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for APMAP Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I would like to purchase one of your antibodies, but before I do I have some questions. The antibody I'm talking about is raised against APMAP (C20orf3). I've seen that I can select between 3 different antibodies (NBP1-59983, N00057136-B101P, NBP1-59984). Coming to my questions. I'm working mainly with murine cells and tissues and I've seen that your antibodies are just predicted to raise against mouse-Apmap. Furthermore, in addition to western blotting I would like to use this antibody for immunofluorescence of cells. Which one would you suggest to use? 

    A: In regards to your inquiry I would recommend either NBP1-59983 or NBP1-59984 as they have been validated in murine samples; you would just need to decide if you prefer a C-term or an N-term target. Catalog number H00057136-B01P has only been validated for human samples so it would not be guaranteed in mouse. If you plan on doing IF as well we have a program called our Innovator's Reward program that you may want to take advantage of.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...