Apolipoprotein B/ApoB Antibody (2T5X0)

Novus Biologicals | Catalog # NBP3-16350

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2T5X0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Apolipoprotein B/ApoB (P04114). RKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Apolipoprotein B/ApoB Antibody (2T5X0)

Western Blot: Apolipoprotein B/ApoB Antibody (2T5X0) [NBP3-16350]

Western Blot: Apolipoprotein B/ApoB Antibody (2T5X0) [NBP3-16350]

Western Blot: Apolipoprotein B/ApoB Antibody (2T5X0) [NBP3-16350] - Western blot analysis of extracts of various cell lines, using Apolipoprotein B/ApoB Rabbit mAb (NBP3-16350) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Applications for Apolipoprotein B/ApoB Antibody (2T5X0)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Apolipoprotein B/ApoB

Apolipoprotein B (apo B) in human plasma is a major protein of low density lipoproteins (LDL). The molecular mass is 260 kDa. Apo B binds to specific receptors on cell membranes and is involved in removal of LDL and very low density lipoprotein (VLDL) cholesterol from circulation.

Alternate Names

APOB, ApoB-100, ApoB-48, FLDB, LDLCQ4

Gene Symbol

APOB

Additional Apolipoprotein B/ApoB Products

Product Documents for Apolipoprotein B/ApoB Antibody (2T5X0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Apolipoprotein B/ApoB Antibody (2T5X0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Apolipoprotein B/ApoB Antibody (2T5X0)

There are currently no reviews for this product. Be the first to review Apolipoprotein B/ApoB Antibody (2T5X0) and earn rewards!

Have you used Apolipoprotein B/ApoB Antibody (2T5X0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies