Argininosuccinate Lyase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55125

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Argininosuccinate Lyase Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ASL(argininosuccinate lyase) The peptide sequence was selected from the middle region of ASL. Peptide sequence LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Argininosuccinate Lyase Antibody - BSA Free

Western Blot: Argininosuccinate Lyase Antibody [NBP1-55125]

Western Blot: Argininosuccinate Lyase Antibody [NBP1-55125]

Western Blot: Argininosuccinate Lyase Antibody [NBP1-55125] - Titration: 5.0ug/ml Positive Control: Human Liver.
Western Blot: Argininosuccinate Lyase Antibody [NBP1-55125]

Western Blot: Argininosuccinate Lyase Antibody [NBP1-55125]

Western Blot: Argininosuccinate Lyase Antibody [NBP1-55125] - Lanes: Lane1 : 10 ug COS-7 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit HRP Secondary, Antibody Dilution: 1 : 2000 Gene name: ASL.

Applications for Argininosuccinate Lyase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Argininosuccinate Lyase

ASL is a member of the lyase 1 family. The protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in its gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency.This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

argininosuccinase, argininosuccinate lyase, Arginosuccinase, ASAL, EC 4.3.2.1

Gene Symbol

ASL

Additional Argininosuccinate Lyase Products

Product Documents for Argininosuccinate Lyase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Argininosuccinate Lyase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Argininosuccinate Lyase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Argininosuccinate Lyase Antibody - BSA Free and earn rewards!

Have you used Argininosuccinate Lyase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies