Argonaute 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91494

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Argonaute 3 Primary Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence VHAVDVVLRHLPSMKYTPVGRSFFSAPEGYDHPLGGGREVWFGFHQSVRP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Argonaute 3 Antibody - BSA Free

Western Blot: Argonaute 3 Antibody [NBP1-91494]

Western Blot: Argonaute 3 Antibody [NBP1-91494]

Western Blot: Argonaute 3 Antibody [NBP1-91494] - Mouse Pancreas Lysate 1ug/ml Gel Concentration 6-18%

Applications for Argonaute 3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Argonaute 3

Argonaute 3 encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a tandem cluster of closely related family members including argonaute 4 and eukaryotic translation initiation factor 2C, 1. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

AGO3argonaute 3, Argonaute3, eIF2C 3, eIF-2C 3, Eukaryotic translation initiation factor 2C 3, eukaryotic translation initiation factor 2C, 3, FLJ12765, hAgo3, MGC86946, protein argonaute-3

Gene Symbol

AGO3

UniProt

NP_700451 (Mouse)

Additional Argonaute 3 Products

Product Documents for Argonaute 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Argonaute 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Argonaute 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Argonaute 3 Antibody - BSA Free and earn rewards!

Have you used Argonaute 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies