ASB17 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15987

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 78-177 of mouse ASB17 (NP_080034.2). GHRFELNFNLEFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCSLALIWRTFTPVYCPSPLSGITPLLYVAQTRQSNILKILLQYGILEREKN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ASB17 Antibody - Azide and BSA Free

Western Blot: ASB17 AntibodyAzide and BSA Free [NBP3-15987]

Western Blot: ASB17 AntibodyAzide and BSA Free [NBP3-15987]

Western Blot: ASB17 Antibody [NBP3-15987] - Western blot analysis of extracts of LNCaP cells, using ASB17 antibody (NBP3-15987) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: ASB17 AntibodyAzide and BSA Free [NBP3-15987]

Western Blot: ASB17 AntibodyAzide and BSA Free [NBP3-15987]

Western Blot: ASB17 Antibody [NBP3-15987] - Western blot analysis of extracts of Rat testis, using ASB17 antibody (NBP3-15987) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Applications for ASB17 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ASB17

ASB17 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3ubiquitin-protein ligase complex which mediates the ubiquitination and subsequentproteasomal degradation of targetproteins

Alternate Names

ankyrin repeat and SOCS box containing 17, ankyrin repeat and SOCS box protein 17, ankyrin repeat and SOCS box-containing 17, ASB-17

Gene Symbol

ASB17

Additional ASB17 Products

Product Documents for ASB17 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ASB17 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ASB17 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ASB17 Antibody - Azide and BSA Free and earn rewards!

Have you used ASB17 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...